PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 297aa    MW: 32545.8 Da    PI: 7.2209
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01615genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-131862347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+ l++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
         EMT01615 18 PWTEEEHRLFLLGLQKLGKGDWRGISRSFVVSRTPTQVASHAQKY 62
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8551167IPR017930Myb domain
SuperFamilySSF466891.12E-161368IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-181466IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.4E-111561IPR009057Homeodomain-like
SMARTSM007175.4E-111565IPR001005SANT/Myb domain
PfamPF002495.7E-111862IPR001005SANT/Myb domain
CDDcd001671.88E-91863No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MHASCSTNGR AERKKGTPWT EEEHRLFLLG LQKLGKGDWR GISRSFVVSR TPTQVASHAQ  60
KYFIRQTNFS RRKRRSSLFD MVPEMGLSAF STYVKLCADT CAFLFNLKPM DESPDGAEEF  120
TLCTTQDETT SSNKLSLFHL GRQKEAECDK DLPTLQLRQH EESEYAGPSL EAPDLEMNNG  180
VSFKAASVST VPAFYPALLP VPLTLWPANV SNVEAANATH EVLKPTPVNL KEAIKADEVV  240
SMSKLSIGGG TSGSMEPSAL SLQLTGPTNT RQSAFHVSPP MTRTDLSQGN NSPIHAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564624.11e-163PREDICTED: uncharacterized protein LOC100828575
TrEMBLN1QRK20.0N1QRK2_AEGTA; Myb-like protein J
STRINGMLOC_76271.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19393791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-42MYB_related family protein